metapredict from the command-line¶
Using the original metapredict network¶
We have recently updated the network that makes predictions for metapredict to massively improve accuracy. However, if you need to use the original metapredict predictor as opposed to our new, updated predictor, use the -l
or --legacy
flag!
Predicting Disorder from Fasta Files¶
The metapredict-predict-disorder
command from the command line takes a .fasta file as input and returns disorder scores for the sequences in the FASTA file.
Once metapredict is installed, the user can run metapredict-predict-disorder
from the command line:
$ metapredict-predict-disorder <Path to .fasta file>
Example:
$ metapredict-predict-disorder /Users/thisUser/Desktop/interestingProteins.fasta
Additional Usage:
Specifying where to save the output -
If you would like to specify where to save the output, simply use the -o
or --output-file
flag and then specify the file path and file name. By default this command will save the output file as disorder_scores.csv to your current working directory. However, you can specify the file name in the output path.
Example:
$ metapredict-predict-disorder /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/disorder_predictions/my_disorder_predictions.csv
Using the original metapredict network-
To use the original metapredict network, simply use the -l
or --legacy
flag.
Example:
$ metapredict-predict-disorder /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/disorder_predictions/my_disorder_predictions.csv -l
Predicting Disorder from a Sequence¶
metapredict-quick-predict
is a command that will let you input a sequence and get disorder values immediately printed to the terminal. The only argument that can be input is the sequence.
Example:
$ metapredict-quick-predict ISQQMQAQPAMVKSQQQQQQQQQQHQHQQQQLQQQQQLQMSQQQVQQQGIYNNGTIAVAN
Using the original metapredict network-
To use the original metapredict network, simply use the -l
or --legacy
flag.
Example:
$ metapredict-quick-predict ISQQMQAQPAMVKSQQQQQQQQQQHQHQQQQLQQQQQLQMSQQQVQQQGIYNNGTIAVA -l
Predicting AlphaFold2 Confidence Scores from a Fasta File¶
The metapredict-predict-pLDDT
command from the command line takes a .fasta file as input and returns predicted AlphaFold2 pLDDT confidence scores for the sequences in the FASTA file.
$ metapredict-predict-pLDDT <Path to .fasta file>
Example
$ metapredict-predict-pLDDT /Users/thisUser/Desktop/interestingProteins.fasta
Additional Usage
Specify where to save the output -
If you would like to specify where to save the output, simply use the -o
or --output-file
flag and then specify the file path. By default this command will save the output file as pLDDT_scores.csv to your current working directory. However, you can specify the file name in the output path.
Example
$ metapredict-predict-pLDDT /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/disorder_predictions/my_pLDDT_predictions.csv
Graphing Disorder from a Fasta file¶
The metapredict-graph-disorder
command from the command line takes a .fasta file as input and returns a graph for every sequence within the .fasta file. Warning This will return a graph for every sequence in the FASTA file.
$ metapredict-graph-disorder <Path to .fasta file>
Example
$ metapredict-graph-disorder /Users/thisUser/Desktop/interestingProteins.fasta
If no output directory is specified, this function will make an output directory in the current working directory called disorder_out. This directory will hold all generated graphs.
Additional Usage
Adding AlphaFold2 Confidence Scores -
To add predicted AlphaFold2 pLDDT confidence scores, simply use the -p
or --pLDDT
flag.
Example
$ metapredict-graph-disorder /Users/thisUser/Desktop/interestingProteins.fasta p
Specifying where to save the output -
To specify where to dave the output, simply use the -o
or --output-directory
flag.
Example
$ metapredict-graph-disorder /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/FolderForCoolPredictions
Changing resolution of saved graphs -
By default, the output graphs have a DPI of 150. However, the user can change the DPI of the output (higher values have greater resolution but take up more space). To change the DPI simply add the flag -D
or --dpi
followed by the wanted DPI value.
Example
$ metapredict-graph-disorder /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/DisorderGraphsFolder/ -D 300
Changing the file type -
By default the graphs will save as .png files. However, you can specify the file type by calling --filetype
and then specifying the file type. Any matplotlib compatible file extension should work (for example, pdf).
Example
$ metapredict-graph-disorder /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/DisorderGraphsFolder/ --filetype pdf
Indexing file names -
If you would like to index the file names with a leading unique integer starting at 1, use the --indexed-filenames
flag.
Example
$ metapredict-graph-disorder /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/DisorderGraphsFolder/ --indexed-filenames
Changing the disorder threshold line on the graph -
If you would like to change the disorder threshold line plotted on the graph, use the --disorder-threshold
flag followed by some value between 0 and 1. Default is 0.3.
Example
$ metapredict-graph-disorder /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/DisorderGraphsFolder/ --disorder-threshold 0.5
Using the original metapredict network-
To use the original metapredict network, simply use the -l
or --legacy
flag.
Example:
$ metapredict-graph-disorder /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/DisorderGraphsFolder/ --disorder-threshold 0.5 -l
Quick Graphing¶
metapredict-quick-graph
is a command that will let you input a sequence and get a plot of the disorder back immediately. You cannot input fasta files for this command. The command only takes three arguments, 1. the sequence 2. optional DPI -D
or --dpi
of the output graph which defaults to 150 DPI, and 3. optional to include predicted AlphaFold2 confidence scores, use the p
or --pLDDT
flag.
Example:
$ metapredict-quick-graph ISQQMQAQPAMVKSQQQQQQQQQQHQHQQQQLQQQQQLQMSQQQVQQQGIYNNGTIAVAN
Example:
$ metapredict-quick-graph ISQQMQAQPAMVKSQQQQQQQQQQHQHQQQQLQQQQQLQMSQQQVQQQGIYNNGTIAVAN -p
Example:
$ metapredict-quick-graph ISQQMQAQPAMVKSQQQQQQQQQQHQHQQQQLQQQQQLQMSQQQVQQQGIYNNGTIAVAN -D 200
Using the original metapredict network-
To use the original metapredict network, simply use the -l
or --legacy
flag.
Example:
$ metapredict-quick-graph ISQQMQAQPAMVKSQQQQQQQQQQHQHQQQQLQQQQQLQMSQQQVQQQGIYNNGTIAVAN -l
Graphing using Uniprot ID¶
metapredict-uniprot
is a command that will let you input any Uniprot ID and get a plot of the disorder for the corresponding protein. The default behavior is to have a plot automatically appear. Apart from the Uniprot ID which is required for this command, the command has four possible additional optional arguments, 1. To include predicted AlphaFold2 pLDDT confidence scores, use the -p
or --pLDDT
flag. DPI can be changed with the -D
or --dpi
flags, default is 150 DPI, 3. Using -o
or --output-file
will save the plot to a specified directory (default is current directory) - filenames and file extensions (pdf, jpg, png, etc) can be specified here. If there is no file name specified, it will save as the Uniprot ID and as a .png, 4. -t
or --title
will let you specify the title of the plot. By default the title will be Disorder for followed by the Uniprot ID.
Example:
$ metapredict-uniprot Q8RYC8
Example:
$ metapredict-uniprot Q8RYC8 -p
Example:
$ metapredict-uniprot Q8RYC8 -D 300
Example:
$ metapredict-uniprot Q8RYC8 -o /Users/ThisUser/Desktop/MyFolder/DisorderGraphs
Example:
$ metapredict-uniprot Q8RYC8 -o /Users/ThisUser/Desktop/MyFolder/DisorderGraphs/my_graph.png
Example:
$ metapredict-uniprot Q8RYC8 -t ARF19
Using the original metapredict network-
To use the original metapredict network, simply use the -l
or --legacy
flag.
Example:
$ metapredict-uniprot Q8RYC8 -l
Graphing disorder using the common name of a protein¶
Sometimes you just don’t know the Uniprot ID for your favorite protein, and looking it up can be a pain. With the metapredict-name
command, you can input the common name of your favorite protein and get a graph in return. Metapredict will also print the name of the organisms and the uniprot ID it found so you know you’re looking at the correct protein. This is because this functionality queries your input protein name on Uniprot and takes the top hit. Sometimes this is the protein you’re looking for, but not always. To increase the likelihood of success, use your protein name and the organism name for this command.
Example
$ metapredict-name p53
will graph the metapredict disorder scores for the Homo sapiens p53 protein. This is because Homo sapiens p53 is the top hit on Uniprot when you search p53. However…
$ metapredict-name p53 chicken
will graph the p53 from Gallus gallus!
Additional Usage
Changing the DPI
Changing the DPI will adjust the resolution of the graph. To change the DPI, use the -D
or --dpi
flag.
Example
$ metapredict-name p53 -D 300
Graphing predicted pLDDT scores
To add predicted pLDDT scores to the graph, use the -p
or --pLDDT
flag.
Example
$ metapredict-name p53 -p
Changing the title
To change the title, use the -t
or --title
flag.
Example
$ metapredict-name p53 -t my_cool_graph_of_p53
Using the legacy version of metapredict
To use the legacy version of metapredict for your disorder scores, use the -l
or --legacy
flag.
Example
$ metapredict-name p53 -l
Printing the full Uniprot ID to your terminal
To have your terminal print the entire Uniprot ID as well as the full protein sequence from your specified protein upon graphing, use the -v
or --verbose
flag.
Example
$ metapredict-name p53 -v
Turning off all printing to the terminal
By default, the metapredict-name command prints the uniprot ID as well as other information related to your protein to the terminal. The purpose of this is to make it explicitly clear which protein was graphed because grabbing the top hit from Uniprot does not guarantee that it is the protein you want or expected. However, this behavior can be turned off by using the -s
or --silent
flag.
Example
$ metapredict-name p53 -s
Graphing Predicted AlphaFold2 pLDDT Scores from a fasta file¶
The metapredict-graph-pLDDT
command from the command line takes a .fasta file as input and returns a graph of the predicted AlphaFold2 pLDDT confidence score for every sequence within the .fasta file. Warning This will return a graph for every sequence in the FASTA file.
$ metapredict-graph-pLDDT <Path to .fasta file>
Example
$ metapredict-graph-pLDDT /Users/thisUser/Desktop/interestingProteins.fasta
If no output directory is specified, this function will make an output directory in the current working directory called pLDDT_out. This directory will hold all generated graphs.
Additional Usage
Specifying where to save the output -
To specify where to dave the output, simply use the -o
or --output-directory
flag.
Example
$ metapredict-graph-pLDDT /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/FolderForCoolPredictions
Changing resolution of saved graphs -
By default, the output graphs have a DPI of 150. However, the user can change the DPI of the output (higher values have greater resolution but take up more space). To change the DPI simply add the flag -D
or --dpi
followed by the wanted DPI value.
Example
$ metapredict-graph-pLDDT /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/pLDDTGraphsFolder/ -D 300
Changing the file type -
By default the graphs will save as .png files. However, you can specify the file type by calling --filetype
and then specifying the file type. Any matplotlib compatible file extension should work (for example, pdf).
Example
$ metapredict-graph-pLDDT /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/pLDDTGraphsFolder/ --filetype pdf
Indexing file names -
If you would like to index the file names with a leading unique integer starting at 1, use the --indexed-filenames
flag.
Example
$ metapredict-graph-pLDDT /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/pLDDTGraphsFolder/ --indexed-filenames
Predicting IDRs from a fasta file¶
The metapredict-predict-idrs
command from the command line takes a .fasta file as input and returns a .fasta file containing the IDRs for every sequence from the input .fasta file.
$ metapredict-predict-idrs <Path to .fasta file>
Example
$ metapredict-predict-idrs /Users/thisUser/Desktop/interestingProteins.fasta
Additional Usage
specifying where to save the output -
If you would like to specify where to save the output, simply use the -o
or --output-file
flag and then specify the file path and file name.
Example
$ metapredict-predict-idrs /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/disorder_predictions/my_idrs.fasta
Using the original metapredict predictor
To use the original metapredict predictor as opposed to our new, updated predictor, use the -l
or --legacy
flag!
Example
$ metapredict-predict-idrs /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/disorder_predictions/my_idrs.fasta -l
Changing output threshold for disorder-
To change the cutoff value for something to be considered disordered, simply use the --threshold
flag and then specify your value. For legacy, the default is 0.42. For the new version of metapredict, the value is 0.5.
Example
$ metapredict-predict-idrs /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/disorder_predictions/my_idrs.fasta --threshold 0.3