metapredict from the command-line

A quick note on selecting the metapredict network

Over three iterations we have updated the network behind metapredict to improve prediction accuracy. In case you were using a specific version for something or prefer one version over another, we implemented our updates such that all networks generated previously are still available. You can specify any of the metapredict disorder prediction networks by using the -v or --version flag and choosing 1, 2, or 3!

Predicting Disorder Scores from FASTA Files

The metapredict-predict-disorder command-line tool processes a .fasta file as input and generates disorder scores for each sequence in the file. The results are saved to a .csv file for further analysis.

Once metapredict is installed, you can run metapredict-predict-disorder from the command line:

$ metapredict-predict-disorder <Path to .fasta file>

Example of usage:

$ metapredict-predict-disorder /Users/thisUser/Desktop/interestingProteins.fasta

By default, the results are saved to a disorder_scores.csv file in the current working directory. Additionally, a progress bar is displayed, and predictions will automatically use a GPU if one is available.

Note that as of metapredict V3, all three networks can be submitted in batch for massive increases in prediction speed. Further, metapredict will automatically use a GPU (CUDA, or Apple Silicon MPS) if available. A progress bar will also be generated in the terminal.

Additional Usage

Specifying Output Location

Use the -o or --output-file flag to specify the desired output file path and name. By default, the output is saved as disorder_scores.csv in the current directory.

Example:

$ metapredict-predict-disorder /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/disorder_predictions/my_disorder_predictions.csv
Selecting a Specific Version of metapredict

To use a specific version (e.g., V1, V2, or V3) of metapredict, use the -v or --version flag. This allows you to run predictions using previous network versions for compatibility.

Example:

$ metapredict-predict-disorder /Users/thisUser/Desktop/interestingProteins.fasta -v 1
Specifying the Device for Prediction

You can manually specify the device for prediction with the -d or --device flag. Available options are cpu, mps (for Apple Silicon), cuda (for GPUs), or cuda:int to specify a specific GPU by its index.

By default, metapredict automatically selects a device in the order CUDA GPU → Apple Silicon MPS → CPU, using the first one that is available.

Example:

$ metapredict-predict-disorder interestingProteins.fasta -d cuda:0
Silencing Output

To suppress output and the progress bar, use the -s or --silent flag. This option is useful when running predictions in scripts where minimal output is preferred.

Example:

$ metapredict-predict-disorder interestingProteins.fasta -s
Additional Notes
  1. Error Handling: If the input file is missing or invalid, an error message will be displayed, and the script will terminate.

  2. Relative vs Absolute Paths: You can provide either relative or absolute paths for both input and output files. If the specified output directory doesn’t exist, you may encounter an error, so ensure the directory is created beforehand.

Handling Non-Standard Amino Acids

Use the --invalid-sequence-action flag to control how sequences containing non-standard amino acids are handled when the input FASTA file is parsed. The default is convert, which converts non-standard residues to their closest standard amino acid. See the protfasta documentation for the full list of options.

Example:

$ metapredict-predict-disorder interestingProteins.fasta --invalid-sequence-action convert

Predicting IDRs from a fasta file

The metapredict-predict-idrs command from the command line takes a .fasta file as input and returns a .fasta file containing the IDRs for every sequence from the input .fasta file.

The metapredict-predict-disorder command-line tool processes a .fasta file as input and returns a .fasta file containing the IDRs for every sequence from the input file.

$ metapredict-predict-idrs <Path to .fasta file>

Example of usage:

$ metapredict-predict-idrs /Users/thisUser/Desktop/interestingProteins.fasta

As of metapredict V3, you can automatically parallelize any metapredict network on a GPU or CPU if available.

Additional Usage

Specifying Output Location

If you would like to specify where to save the output, simply use the -o or --output-file flag and then specify the file path and file name. By default, the file will be saved as idrs.fasta (if using –mode fasta) or shephard_idrs.tsv for the shephard-domains, shephard-domains-uniprot modes.

Example

$ metapredict-predict-idrs /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/disorder_predictions/my_idrs.fasta
Selecting a Specific Version of metapredict

If you want to use a version of metapredict other than the default (V3), you can specify the version by using the -v or --version flag and choosing 1, 2, or 3!

Example

$ metapredict-predict-idrs /Users/thisUser/Desktop/interestingProteins.fasta -v 2

Selecting Prediction Output Mode

Use the --mode flag to define how IDRs are reported. Available options are: - fasta: Outputs a FASTA file with IDR start and end positions added to the header. - shephard-domains: Generates a SHEPHARD-compliant domains file with 1-based indexing. - shephard-domains-uniprot: Extracts the UniProt ID from the header and generates a SHEPHARD-compliant domains file.

By default, predictions are reported in fasta mode.

Example:

$ metapredict-predict-idrs /Users/thisUser/Desktop/interestingProteins.fasta --mode shephard-domains

Adjusting Disorder Threshold

The --threshold flag allows you to specify a custom disorder threshold. By default, the threshold is 0.42 for version 1 and 0.5 for versions 2 and 3.

Example:

$ metapredict-predict-idrs /Users/thisUser/Desktop/interestingProteins.fasta --threshold 0.45

Specifying the Device for Prediction

Use the -d or --device flag to choose the device for prediction. Available options include cpu, mps (for Apple Silicon), cuda (for GPUs), or cuda:int to specify a specific GPU by its index.

By default, metapredict-predict-idrs automatically selects a device in the order CUDA GPU → Apple Silicon MPS → CPU, using the first one that is available.

Example:

$ metapredict-predict-idrs interestingProteins.fasta -d cuda:0
Handling Non-Standard Amino Acids

Use the --invalid-sequence-action flag to control how sequences containing non-standard amino acids are handled when the input FASTA file is parsed. The default is convert, which converts non-standard residues to their closest standard amino acid. See the protfasta documentation for the full list of options.

Example:

$ metapredict-predict-idrs interestingProteins.fasta --invalid-sequence-action convert
Printing Status Updates

Use the --verbose flag to print status updates to the terminal as IDRs are predicted.

Example:

$ metapredict-predict-idrs interestingProteins.fasta --verbose

Predicting disorder scores from sequence

The metapredict-quick-predict command-line tool allows you to input an amino acid sequence directly via the command line and receive the disorder prediction values. It provides a fast way to predict intrinsic disorder for short sequences without the need for a FASTA file.

Example:

$ metapredict-quick-predict <Amino Acid Sequence>

Example of usage:

$ metapredict-quick-predict MVKVGVNGFGRIGRLVTRAAFNSGKVDIVLDSGDGVTHVVQ

Specifying the metapredict network

To use a specific version (e.g., V1, V2, or V3) of metapredict, use the -v or --version flag. This allows you to run the disorder prediction with different versions of the model.

Example:

$ metapredict-quick-predict MVKVGVNGFGRIGRLVTRAAFNSGKVDIVLDSGDGVTHVVQ -v 2

Predicting AlphaFold2 Confidence Scores from a FASTA File

The metapredict-predict-pLDDT command-line tool allows you to generate AlphaFold2 pLDDTscores for sequences in a FASTA file.

$ metapredict-predict-pLDDT <FASTA File>

Example of usage:

$ metapredict-predict-pLDDT input_sequences.fasta

By default, the script will generate a CSV file called pLDDT_scores.csv with pLDDT scores for each sequence in the input FASTA file.

Additional Usage

Specifying an Output File

To specify a custom output file where the pLDDT scores should be saved, use the -o or --output-file flag.

Example:

$ metapredict-predict-pLDDT input_sequences.fasta -o my_plddt_scores.csv
Specifying a Specific Version of the pLDDT predictor

To use a specific version of the pLDDT model (e.g., V1, V2), use the -v or --pLDDT-version flag. This allows you to specify which version of the model to use for generating the pLDDT scores.

Example:

$ metapredict-predict-pLDDT input_sequences.fasta -v 1
Suppressing the Progress Bar

If you want to suppress the progress bar, use the -s or --silent flag. This is useful if you want a cleaner output without the progress bar display.

Example:

$ metapredict-predict-pLDDT input_sequences.fasta -s
Specifying the Device

To specify the device to run the prediction on (CPU, MPS, CUDA), use the -d or --device flag.

Example:

$ metapredict-predict-pLDDT input_sequences.fasta -d cuda:0
Handling Non-Standard Amino Acids

Use the --invalid-sequence-action flag to control how sequences containing non-standard amino acids are handled when the input FASTA file is parsed. The default is convert, which converts non-standard residues to their closest standard amino acid. See the protfasta documentation for the full list of options.

Example:

$ metapredict-predict-pLDDT interestingProteins.fasta --invalid-sequence-action convert

Generate Disorder Plots from FASTA files

The metapredict-graph-disorder command from the command line takes a .fasta file as input and returns a graph for every sequence within the .fasta file. Warning This will return a graph for every sequence in the FASTA file.

$ metapredict-graph-disorder <FASTA File>

Example of usage:

$ metapredict-graph-disorder input_sequences.fasta

NOTE: If no output directory is specified, this function will make an output directory in the current working directory called disorder_out/. This directory will hold all generated graphs.

Additional Usage

Specifying an Output Directory

To specify a custom directory for the generated graphs, use the -o or --output-directory flag. If not provided, the output graphs will be saved in a default directory called disorder_out.

Example:

$ metapredict-graph-disorder input_sequences.fasta -o custom_output_dir
Specifying a Specific Version of metapredict

You can specify a specific version of the metapredict model (e.g., 1, 2, 3) by using the -v or --version flag.

Example:

$ metapredict-graph-disorder input_sequences.fasta -v 2
Including Predicted AlphaFold2 pLDDT Scores in the Graph

To include AlphaFold2 pLDDT scores in the graph, use the -p or --pLDDT flag.

Example:

$ metapredict-graph-disorder input_sequences.fasta -p
Specifying a pLDDT Version

To specify which version of the pLDDT predictor to use (V1 or V2), use the -pv or --pLDDT_version flag.

Example:

$ metapredict-graph-disorder input_sequences.fasta -pv 2
Setting the DPI for Graph Resolution

You can adjust the resolution of the generated graphs by setting the DPI (dots per inch) using the -D or --dpi flag. The default DPI is 150.

Example:

$ metapredict-graph-disorder input_sequences.fasta -D 300
Setting the Output Filetype

The output filetype can be specified using the --filetype flag. The valid options are png, pdf, and jpg, with png as the default.

Example:

$ metapredict-graph-disorder input_sequences.fasta --filetype pdf
Indexing Filenames

If you want the generated graph files to have indexed filenames (e.g., 1_filename.png), use the --indexed-filenames flag.

Example:

$ metapredict-graph-disorder input_sequences.fasta --indexed-filenames
Setting the Disorder Threshold Line

If you would like to change the disorder threshold line plotted on the graph, use the --disorder-threshold flag followed by some value between 0 and 1. Default is 0.42 for V1 and 0.5 for V2 and V3.

Example

$ metapredict-graph-disorder /Users/thisUser/Desktop/interestingProteins.fasta -o /Users/thisUser/Desktop/DisorderGraphsFolder/ --disorder-threshold 0.5
Handling Non-Standard Amino Acids

Use the --invalid-sequence-action flag to control how sequences containing non-standard amino acids are handled when the input FASTA file is parsed. The default is convert, which converts non-standard residues to their closest standard amino acid. See the protfasta documentation for the full list of options.

Example:

$ metapredict-graph-disorder interestingProteins.fasta --invalid-sequence-action convert

Quick Disorder Graph for a Sequence

The metapredict-quick-graph command-line tool allows you to quickly visualize the intrinsic disorder of a single amino acid sequence directly from the command line. This tool can also optionally include AlphaFold2 pLDDT (predicted Local Distance Difference Test) scores in the generated graph.

Example:

$ metapredict-quick-graph <Amino Acid Sequence>

Example of usage:

To visualize the disorder profile of the sequence THISISASEQWENCE, you would run:

$ metapredict-quick-graph THISISASEQWENCE

This will generate a disorder graph for the sequence and display it.

Additional Usage

Specifying a Specific Version of metapredict

You can specify a specific version of the metapredict model (e.g., V1, V2, or V3) by using the -v or --version flag.

Example:

$ metapredict-quick-graph THISISASEQWENCE -v 2
Including AlphaFold2 pLDDT Scores in the Graph

To include AlphaFold2 pLDDT scores in the graph, use the -p or --pLDDT flag.

Example:

$ metapredict-quick-graph THISISASEQWENCE -p
Setting the DPI for Graph Resolution

You can adjust the resolution of the generated graph by setting the DPI (dots per inch) using the -D or --dpi flag. The default DPI is 150.

Example:

$ metapredict-quick-graph THISISASEQWENCE -D 300
Specifying a pLDDT Version

To specify which version of the pLDDT predictor to use (V1 or V2), use the -pv or --pLDDT_version flag.

Example:

$ metapredict-quick-graph THISISASEQWENCE -pv 2

Graph Disorder from UniProt Accession

The metapredict-uniprot command-line tool allows you to graph the predicted intrinsic disorder of a protein sequence using a UniProt accession number. This tool can also include AlphaFold2 pLDDT (predicted Local Distance Difference Test) scores in the generated graph.

Example

$ metapredict-uniprot <UniProt Accession>

Example of usage:

To visualize the disorder profile of a protein with the UniProt accession P12345, you would run:

$ metapredict-uniprot P12345

This will generate a disorder graph for the protein sequence associated with the UniProt accession and display it.

Additional Usage

Specifying a Specific Version of metapredict

You can specify a specific version of the metapredict model (e.g., V1, V2, or V3) by using the -v or --version flag.

Example:

$ metapredict-uniprot P12345 -v 2
Including AlphaFold2 pLDDT Scores in the Graph

To include AlphaFold2 pLDDT scores in the graph, use the -p or --pLDDT flag.

Example:

$ metapredict-uniprot P12345 -p
Setting the DPI for Graph Resolution

You can adjust the resolution of the generated graph by setting the DPI (dots per inch) using the -D or --dpi flag. The default DPI is 150.

Example:

$ metapredict-uniprot P12345 -D 300
Specifying a pLDDT Version

To specify which version of the pLDDT predictor to use (V1 or V2), use the -pv or --pLDDT_version flag.

Example:

$ metapredict-uniprot P12345 -pv 1
Providing a Custom Title for the Graph

You can provide a custom title for the graph using the -t or --title flag.

Example:

$ metapredict-uniprot P12345 -t "Disorder Prediction for Protein X"
Saving the Graph to a File

You can specify the output file where the graph will be saved using the -o or --output-file flag. The file extension (e.g., pdf, png, jpg) determines the file format. If no filename is provided, the output will be saved using the UniProt accession ID as the filename.

Example:

To save the graph as a PNG file:

$ metapredict-uniprot P12345 -o disorder_graph.png

If no output filename is provided, the graph will be saved with the UniProt accession number as the filename (e.g., P12345.png).

Suppressing the Printed Output

If you prefer to suppress any printed output, specifically when saving the generated graph, use the -s or --silent flag.

Example:

$ metapredict-uniprot P12345 -o disorder_graph.png -s

Graph Disorder from Protein Name

The metapredict-name command-line tool allows you to predict the intrinsic disorder of a protein sequence using a protein name (and ideally also the organism name…). This tool can also include AlphaFold2 pLDDT (predicted Local Distance Difference Test) scores in the generated graph.

Example

$ metapredict-name <Protein Name>

Example of usage:

To visualize the disorder profile of a protein named p53, you would run:

$ metapredict-name p53

This will generate a disorder graph for the protein sequence associated with the provided name.

Additional Usage

Specifying a Specific Version of metapredict

You can specify a specific version of the metapredict model (e.g., V1, V2, or V3) by using the -v or --version flag.

Example:

$ metapredict-name P53 -v 2
Including AlphaFold2 pLDDT Scores in the Graph

To include AlphaFold2 pLDDT scores in the graph, use the -p or --pLDDT flag.

Example:

$ metapredict-name P53 -p
Setting the DPI for Graph Resolution

You can adjust the resolution of the generated graph by setting the DPI (dots per inch) using the -D or --dpi flag. The default DPI is 150.

Example:

$ metapredict-name P53 -D 300
Specifying a pLDDT Version

To specify which version of the pLDDT predictor to use (V1 or V2), use the -pv or --pLDDT_version flag.

Example:

$ metapredict-name P53 -pv 2
Providing a Custom Title for the Graph

You can provide a custom title for the graph using the -t or --title flag.

Example:

$ metapredict-name P53 -t "Disorder Prediction for P53"
Suppressing Terminal Output

If you prefer to suppress all printed text during execution, use the -s or --silent flag.

Example:

$ metapredict-name P53 -s

Generate AlphaFold2 pLDDT Score Figures from FASTA

The metapredict-graph-pLDDT command-line tool generates AlphaFold2 pLDDT score figures for all sequences in a FASTA file.

Example

$ metapredict-graph-pLDDT <FASTA file path>

Example of usage:

To visualize the pLDDT scores for all sequences in a FASTA file named proteins.fasta, you would run:

$ metapredict-graph-pLDDT proteins.fasta

This will generate pLDDT score graphs for each sequence in the provided FASTA file.

Additional Usage

Setting the DPI for Graph Resolution

You can adjust the resolution of the generated graphs by setting the DPI (dots per inch) using the -D or --dpi flag. The default DPI is 150.

Example:

$ metapredict-graph-pLDDT proteins.fasta -D 300
Specifying the Output Filetype

You can specify the output filetype (e.g., PNG, PDF, JPG) for the generated graphs using the --filetype flag. The default filetype is PNG.

Example:

$ metapredict-graph-pLDDT proteins.fasta --filetype pdf
Defining the Output Directory

You can define a custom output directory using the -o or --output-directory flag. If not provided, the tool will save the graphs to a default directory named pLDDT_out.

Example:

$ metapredict-graph-pLDDT proteins.fasta -o custom_output_dir
Indexing Output Filenames

To index the output filenames with a leading unique integer, use the --indexed-filenames flag.

Example:

$ metapredict-graph-pLDDT proteins.fasta --indexed-filenames
Specifying the pLDDT Version

You can specify which version of the pLDDT predictor to use (V1 or V2) with the -v or --pLDDT-version flag. The default version is determined by the DEFAULT_NETWORK_PLDDT setting.

Example:

$ metapredict-graph-pLDDT proteins.fasta -v V2
Handling Non-Standard Amino Acids

Use the --invalid-sequence-action flag to control how sequences containing non-standard amino acids are handled when the input FASTA file is parsed. The default is convert, which converts non-standard residues to their closest standard amino acid. See the protfasta documentation for the full list of options.

Example:

$ metapredict-graph-pLDDT interestingProteins.fasta --invalid-sequence-action convert

Generate Disorder Scores for CAID from a FASTA file

The metapredict-caid allows you to easily run predictions of .fasta formatted files and returns a ‘CAID compliant’ formatted file per sequence that is in the fasta file.

Example:

$ metapredict-caid <FASTA file path> <output path> <version>

Example of usage:

To generate disorder scores for all sequences in a FASTA file named proteins.fasta and save the output to the directory output/, using version v2 of Metapredict, you would run:

$ metapredict-caid proteins.fasta output/ v2

This will generate .caid files with the disorder scores for each sequence in the specified output directory.

Additional information

FASTA Input File

The first argument is the path to the FASTA file containing the protein sequences for which disorder scores will be predicted.

Example:

$ metapredict-caid proteins.fasta output/ v2
Output Directory

The second argument specifies the directory where the generated .caid files will be saved. If the directory does not exist, it will be created.

Example:

$ metapredict-caid proteins.fasta output/ v2
Version

The third argument specifies the version of Metapredict to use. The options are: - v1 - v2 - v3

Example:

$ metapredict-caid proteins.fasta output/ v3
CAID Output Binarization: Algorithmic Domain Assignment

By default, metapredict-caid uses an algorithmic approach to assign binary labels for IDRs and folded domains. Instead of applying a strict per-residue disorder score cutoff, metapredict decomposes each sequence into contiguous intrinsically disordered regions (IDRs) and folded domains using a domain segmentation algorithm. This results in more biologically meaningful domain assignments that better reflect the underlying disorder/folded state segmentation.

If you prefer the legacy strict cutoff-based assignment, you can use the --use-fixed-cutoff flag to specify a threshold for per-residue binarization.